Which environment does the Sphaerodactylus parthenopion typically avoid compared to other geckos like Sphaerodactylus macrolepis?

Answer

Beaches and rotting palm debris

The Sphaerodactylus parthenopion exhibits distinct habitat preferences that differentiate it from sympatric species like the least gecko, or Sphaerodactylus macrolepis. While other species might occupy areas like beaches or rotting palm debris, the Sphaerodactylus parthenopion is specifically adapted to dry, thorny scrub on rocky hillsides. Its scale morphology and color patterns are optimized for this specific rocky substrate, rather than the leaf-litter habitats favored by its relatives.

Which environment does the Sphaerodactylus parthenopion typically avoid compared to other geckos like Sphaerodactylus macrolepis?
animalreptiledwarfcharacteristicgecko